Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485)
Average proteome isoelectric point is 6.62
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,778 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|I3VXY7|I3VXY7_THESW Flagellar hook-associated protein 2
MASYIDTSYMYMMYPYYSDYSYFFNTSNPLTSLSNITTDNISQIAQQALYTDMQNQQLPMQTTNALVMLNSYANNLADAASQLQLTSPDNVFNQMVATSSDPNSISVLAQPGATATTYSVTVNQLAMVQQNNGTSLSSNSVTSLTPGTYSFTAQVGGQQYNISFNVNQGDTNQTVLDNMAQAINSANIGI
TAVVNNNPYLGTSQLEINANNTGTNNAFTLTDVNGNAVSYTGANTVTVEATNANYIINGVSGTSQTNTVNIDNNNLTMTFDKTISNATVTVAPDAQSISDSINNFVNDYNEMLTYANQNQQYISPLVVSELTQSYEYQASNLQAIGITQNPDMTLSIDQNTLNNAIQNNFSTVQAAFAGFDGLAVNVGQF
AGQIAESPLTDYANETMPLVNNNMGIYDSTGMLDASLIQTMLMPSGQFINSLI
Molecular weight: 46.56 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|I3VXF8|I3VXF8_THESW 50S ribosomal protein L35
MPKMKTHSGAAKRFALTKNGKVKRSKAFKRHILTKKTRKTKRNLRKIAYLSSVDAKNIKRLIPYA
Molecular weight: 7.53 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,762 |
16 |
2,778 |
828,153 |
30 |
2,874 |
299.8 |
33.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.09 |
0.89 |
6.21 |
6.56 |
4.3 |
6.62 |
1.39 |
9.72 |
8.55 |
9.05 |
2.71 |
5.75 |
2.33 |
3.21 |
3.58 |
6.18 |
4.82 |
6.98 |
0.76 |
4.3 |
Note: For statistics only major isoforms were used (in this case 2,762 proteins)
For dipeptide frequency statistics click
here