Torque teno zalophus virus 1 (ZcTTV)
Average proteome isoelectric point is 6.39
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|C0JSK7|C0JSK7_ZCTTV Orf2
MEDIRTLWKVTFDLLYDNNYFPSTGMYPCFDEKEICLCLAWTLLLIGFSTLLILTIQLIISVRRLNGSVNALISIKNSAGVVTGQTISPKNAISEEVQAPEMEETLQEVPLSEESPLVGAQTQKMASPTKNACGKIPSF
Molecular weight: 15.34 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|C0JSK8|C0JSK8_ZCTTV Capsid protein
MPFRRRFRRRRWRRPFRRYHYRRNRHWWGRRRRKWRHRRRMPAVRYHPSRRHKYIVIRGIEPLGNLCTDHTPSWLRATPGRSFESAGQTLGEWEGTWGAHHHSFAGLLLRAQCRFATFSGDWKSYDYIEYKGGTFYIPPQCTTFLFGIDPQFTKISKEGEKEQPNEETWLHPGWLLHQRGTHIIYSKDIK
PWRRWYKLRVKPGPTWEGPYSLPNAFNFIMSQWWWSWLDFQHAFEDNTRSQICHADPQNFSLFCGQKPWWFDSTYKNTIEIPKRLVNKACNAWVNRQEYMIKIGQKVTDKMLHPEDDILCGNQSQQSQKKYFQQQNPGWGPFLPLLYNGDNCSLWFKYRYVFKVSGDCEYRKTPSTDLTQMVPTAPGPWN
AEGDRPQIQSRSILKKSRKRPLDTADILLGDTDDGILTETGLERISGPSPKDLLCGMENTPPKRVRFRQSDVLRKHKHRILNLIDQLSR
Molecular weight: 56.1 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
770 |
139 |
469 |
256.7 |
29.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.64 |
1.95 |
4.55 |
5.97 |
4.03 |
5.84 |
3.12 |
5.32 |
5.71 |
8.18 |
1.95 |
3.9 |
5.97 |
6.49 |
7.53 |
8.18 |
7.14 |
3.51 |
3.51 |
3.51 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here