Nannochloropsis gaditana CCMP526
Average proteome isoelectric point is 7.04
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,328 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K8YNF6|K8YNF6_9STRA Uncharacterized protein
MRSFPPAASSPSTTTLQSWDEVYDEEEEALAADDDVEDEVEDDDEELVDTFFGDDDAEDGEEEEELGDDDLQVIEDDDLEMDDDFEEFMEAAEEEEDEEEDEEDEEEEEEEEEDDVAVAEEEEEEEEDEDEDEDEDEDEDEIEDEIEEEDEDEDEDEEEEEEEDEEEDEEEDEVEDEDEDEDEDEDEIEE
EEKDEDVIGEVDWDDDMTQAQDDDLTDDDDYEESMAALQAAEKEGALSSILPVGSTVPEGEEEAGASVLPVQDTEMKEDEEASAGVLPVTPVEDAVAPEASESQVATPPSPMRTPRPTNAVPLPEASGDKEAPEAIAEGGGLPGGNGGAGNGGGMPNLGGIGKGPVGEMVKEGASNLVEGSSPMAGTEGE
AGSESNPMSGAEEEALVEDANAREAESEATTTTTEILPPQADADPSAQSNVKEVLPVEDTVPADGTTGEETVVHSGAGLARTSGLVLAATLVLALVPALAL
Molecular weight: 51.64 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K8YPJ7|K8YPJ7_9STRA Uncharacterized protein (Fragment)
VQLLSLAFPPLPGLRARSYTSPRGAPRSPRPGRRRTARRKGRGRRPTSPRRRRSPRGLESPGPARPGPLGPP
Molecular weight: 7.91 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,277 |
51 |
3,328 |
979,570 |
8 |
4,759 |
298.9 |
32.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.56 |
1.53 |
4.79 |
6.94 |
3.56 |
8.52 |
2.41 |
3.52 |
4.45 |
9.94 |
2.26 |
2.58 |
3.67 |
5.96 |
7.0 |
7.63 |
5.12 |
6.88 |
1.3 |
2.34 |
Note: For statistics only major isoforms were used (in this case 3,277 proteins)
For dipeptide frequency statistics click
here