Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Average proteome isoelectric point is 6.36
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,580 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A7HP75|A7HP75_PARL1 Putative membrane protein glycine-rich
MARNSAKIALAASAMFLVAACNSDGSSFGGGGGGGGGTPSSITSLGVTGEGGVTETLGIAALTDPLLGTEGVLGGGGEGAIGGQLPAELTDAIAPLRDGLAPVVDTVGGSVPVGTVTDQIPSLGIGGEGGLVYDLAGQDPVGMLLGGNGTVPMLLGGGNDGALGDVVPAGAVPGLPGGGDGGDPLAPITD
LLGGGLPGLPGGGDDPLAPVTDLLGGAGGLGVTGDGGVLSSLLGDDPVGPAITPLGPVADLLGGGSDGLLGSIVPADALPGGGGDDPLAPVTDLLGGLPALPGS
Molecular weight: 26.73 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A7HX19|A7HX19_PARL1 Putative histone H1 protein
MATTTKTKAKPKAAAAKKPAAKKPAAAKKKPAAKKTVKKLAAKTTAAKKAPAKKKPAAKKKPAAKKTVKKAVAKKTVAKKAPAKRKPAAKKKPAAKKTAARKPAAKKTTAKKAPAKRKPAAKKPAAKKTAAKKAPAKRKPAAKKPAAKRKPAARKKAA
Molecular weight: 16.26 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,569 |
11 |
3,580 |
1,149,986 |
29 |
3,325 |
322.2 |
35.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.31 |
0.81 |
5.65 |
6.52 |
3.82 |
8.69 |
2.06 |
5.15 |
3.62 |
9.87 |
2.59 |
2.63 |
2.81 |
5.11 |
7.03 |
5.25 |
5.17 |
7.19 |
1.35 |
2.37 |
Note: For statistics only major isoforms were used (in this case 3,569 proteins)
For dipeptide frequency statistics click
here