gamma proteobacterium HdN1
Average proteome isoelectric point is 6.69
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,683 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E1VMH9|E1VMH9_9GAMM Uncharacterized protein
MNFTLKRSLLVAAVATALAGCNLSVKVVDENGNENVGGTVVSADGSINCPAGACSFNYPGFTTKVTLTATAAAGYEFAGFDNVDVICSNGGADANATGVCVTQSMFPKSVVANFREPGVVDICPDDPNDNCLENPEGDFDGDGTKNSEDACPLDAQNACDAGDVDGDGIPNVGDVCPTDPQNNCLANAEG
DFDGDGIKNGDDACAEDATNSCPAGDQDADGVINSGDNCPAVANPGQEDVDGDGIGDACDTDADNDGYPNDQDCSPLDPAINPGAQEIPDGVDNNCDGQVDEGTALVAPSDLHKNGSYTGKFVFAWTPTPFNDGYQVQVVANAGCIAFGTKTFDFAGQVNTGTASASNICLGSKYTAKIRASRNGAWSAW
SSNYTFNN
Molecular weight: 39.6 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E1VIJ9|E1VIJ9_9GAMM 50S ribosomal protein L35
MPKIKTNRGAAKRFRKTANGFKRKQAFKRHILTKKSPKRIRQLRPMSMVHPSDVALVQRMMPYV
Molecular weight: 7.56 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,628 |
55 |
3,683 |
1,325,572 |
34 |
5,494 |
365.4 |
40.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.33 |
1.01 |
5.22 |
5.99 |
3.86 |
7.27 |
2.35 |
5.42 |
4.11 |
10.65 |
2.34 |
3.52 |
4.5 |
4.62 |
6.26 |
6.26 |
5.27 |
6.9 |
1.39 |
2.72 |
Note: For statistics only major isoforms were used (in this case 3,628 proteins)
For dipeptide frequency statistics click
here