Virtual 2D-PAGE plot for 4,659 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|R4X7V0|R4X7V0_TAPDE Uncharacterized protein
MFWAASFSVGSEETEVVADDLVAVLMLVDTFEVEDELGLLVEVADLEVDIEVVVDVILEVGIADEVEATFEVVAIADVEDVVEDEEYGEVEDLEDVVIWEDRIVALLLVLELLIADDVEVEVDLGGATYTGLTPGAFMADVEIAVTVEELLMLDVVVVGLADVEEALAEEELCEVEIAFIGAGT
Molecular weight: 19.79 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|R4XL29|R4XL29_TAPDE Uncharacterized protein
MRRCWNSGTWTRTSRSRRCGLSTGTTRPASSDNSPSARTPRSSSRRHSCPTRTLSRTRCTRRPRSGTAPTSPNSPSFPPGRRSGPSPARRLAPTTRTTSSRSSSNDTFGRPRPSTTSWSSSRRTRRPSRSRTPGPSGHAARRPFKRSRQCPSPRRKRSVTPDGSFGRTG
Molecular weight: 18.68 kDa Isoelectric point according different methods: