European mountain ash ringspot-associated virus (isolate Sorbus aucuparia) (EMARAV)
Average proteome isoelectric point is 6.63
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 4 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q0PI71|VG27_EMARV Uncharacterized 27 kDa protein
MESNKMKSITKMTVNTLQMDSCKAAAKRFKNATWELISNDFNLDIMNMFCILYYACTSHELKLDELVFQTAHKVIMNEVSVSIGESRMFIRIYVSFHMLMGDLNELLHHGISKFEGSPIKDMTSYLIYGEEYVRNLFQSINSTRATPVYQLFITKVPRQFPAITHGDSEYTYMLMVHNYLSTQSIAGVSH
TPSNSDNYVIRTAEEYVHHHYAQLDRQASDNKMRPESSDQME
Molecular weight: 26.86 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q0PI70|NCAP_EMARV Nucleoprotein
MPIIPKPKSQTKGSVESSKKESRVKMETSDAKYMVGNEVKTIKFLDMRGNIATSARNSLNISPGVFAVNPFLGETLAEDTFNILDYAGLGNVDACASHLSRSQELREQVTEKTLREVPISDSYVLKVVSNLQATTVQNVVSFNKACAVMSFNILRHTTDEMYDWTKNEYVSLGLKEKAAKVNPNIINRLA
GQINLSPQSPYYYLVTPGYEFLYDAYPAETIAMTLVKMAYRKTMNLPDSMKDSDICSSLNAKINKRHNLAVNNIDDIIKQIGKKHIEDMYNTLTQNIAMSGKESRNVETAQSFLALIESFKTTT
Molecular weight: 35.08 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4 |
0 |
4 |
3,485 |
232 |
2,293 |
871.2 |
100.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.64 |
1.95 |
6.28 |
5.31 |
4.73 |
3.53 |
2.67 |
8.75 |
8.06 |
9.15 |
2.87 |
6.4 |
3.13 |
3.16 |
3.36 |
8.92 |
6.43 |
5.31 |
0.46 |
5.88 |
Note: For statistics only major isoforms were used (in this case 4 proteins)
For dipeptide frequency statistics click
here