Deltaproteobacteria bacterium DG_8
Average proteome isoelectric point is 7.18
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,192 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S7X2G5|A0A0S7X2G5_9DELT Uncharacterized protein (Fragment)
VSAILATVILISVFTVTAYEYVHANNQSIIIDHTCTNLSQIPEEWITAAKDNLHIAYGHTSHGSQIITGMDGLDVFMGGTGLYVWNDGPLANHLDIDDYAFDDYEAYDLGNPDLTAWVQATRDYLDDPANSDVNVVIWSWCGQVSEMSTAEVTNYLNNMASLEGEYPNVDFVYMTGHLNIWDWATTKANN
QQIREYCIANNKTLYDFADIESYDPDGVFYDYADDNCDYYDDQYGSNQLGNWAQDWQSTHTEGAGGDWYDCGYSDCCAHSQPLNCNQKAYAAWWLWARLAGWDGATPPPLPGIKANNSDGPITLNQSDTLTITVALDNNDITDNADWWLAADTPFGLWFFTFEGWITDWVPAYQGPLFYLDSYEVLNMPI
SGFPLGTYTLHFGIDTVMDGNVTWDSVYYDTVVVNVTE
Molecular weight: 46.93 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S7X771|A0A0S7X771_9DELT 50S ribosomal protein L35
MPKIKTNRGAAKRFSKTKGGKIKRRKAYASHILTKKSAKRKRSLRKSGLLDKVDTKSIRRLIPNL
Molecular weight: 7.43 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,189 |
3 |
1,192 |
344,062 |
38 |
1,406 |
289.4 |
32.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.83 |
1.34 |
4.99 |
7.38 |
4.62 |
6.87 |
2.04 |
8.5 |
7.84 |
10.08 |
2.31 |
4.08 |
2.87 |
4.0 |
4.97 |
6.26 |
5.02 |
6.23 |
1.11 |
3.65 |
Note: For statistics only major isoforms were used (in this case 1,189 proteins)
For dipeptide frequency statistics click
here