Zygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227)
Average proteome isoelectric point is 6.61
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,722 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|S6DYS6|S6DYS6_ZYGB2 BN860_12156g1_1
MLYQVALSFALASTALAEVSGSITYVDETTTPQVTESVVSTEDVTSTPYITTTLSSCTDSSESAAESTAEATGYTAASTPVSTPLSTAASTLTSAPASGSAAETAQQTATSETAVTEETTATAGQDTTTTIHPTDVTSVSCNETSANGTTVFSSSTSVVPTAFSSTSASSSAYANDTTSASGPSTPLSSG
SIVPQSTSASVSPSGSAEDTASSSTAQLETFTAGGSRHVASFGALAAALVALL
Molecular weight: 23.76 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|S6E157|S6E157_ZYGB2 Isoform of S6E8E7 ZYBA0S03-01002g1_1
MLSLARNAFQASARRTFITIGNFSPLKTMGSLPLQRLLGPQLPFGMGQRRWKSRGNTYQPSTLKRKRRVGFLARARSKQGSKILQRRKQKGRWFLTH
Molecular weight: 11.23 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
863 |
3,859 |
4,722 |
750,119 |
65 |
4,050 |
869.2 |
98.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.01 |
1.26 |
5.77 |
6.96 |
4.38 |
5.17 |
2.27 |
5.81 |
6.74 |
9.99 |
2.13 |
5.24 |
4.3 |
4.47 |
4.84 |
8.98 |
5.46 |
5.96 |
1.04 |
3.2 |
Note: For statistics only major isoforms were used (in this case 863 proteins)
For dipeptide frequency statistics click
here