Alloiococcus otitis ATCC 51267
Average proteome isoelectric point is 5.78
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 1,627 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K9EC87|K9EC87_9LACT Uncharacterized protein
MLKKALLILGAGLLTACSMYTVDEEDQEEEASQEEASQGEDSQKEGQESEEDSNDLAFVLQESDRLAQVSPFNDDALAFLSEQVEADEDGEIGEVGELTLDYSGIYLSAEEELYGVYLLTNRLNLDMTNLSFEVTHYNSAGQAVLENYPLYLGSDMFGVLEQGTAMPVYIELPLDDPEAIDGEGFQDGEI
TLANLNFDTEDDLIDGLEEEEVADDDQEEETDDQEDQTPEGYNVGYNPTYVMTVRQQEELLADIESGDVPDLAVTTPPVIANDPQGDDIMAMVQDENIVNPAAGFSLDGQLTLYWTGIATGNYETTIFMLANRTDQAYSDFNLTLDFANSDDQVILDQEELHLSAEDYGQVEANSLTPILVDIPEDSRPA
LERLLDPEEALAPQYELVDSPDQDGESDEGQEDDNDQEEEDQADQVEDN
Molecular weight: 47.42 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K9EAL8|K9EAL8_9LACT 50S ribosomal protein L34
MAQGLTFNPKKRKGKKNHGFRKRMSTKNGRKILKNRRRKGRKRLSY
Molecular weight: 5.56 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,621 |
6 |
1,627 |
510,883 |
35 |
2,489 |
315.2 |
35.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.37 |
0.46 |
7.26 |
6.93 |
4.19 |
6.92 |
1.85 |
7.02 |
5.93 |
10.16 |
2.25 |
4.24 |
5.31 |
3.58 |
4.07 |
6.23 |
4.95 |
6.86 |
0.8 |
3.62 |
Note: For statistics only major isoforms were used (in this case 1,621 proteins)
For dipeptide frequency statistics click
here