Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Average proteome isoelectric point is 6.13
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,638 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A1S9U3|A1S9U3_SHEAM Uncharacterized protein
MKSQAKKSLLALAITAGIGMSAQAFASDISEIQVNQSGYGNDTTVEQTGVLNLAQVDQLGDENTTTVTQDGVWNEAFVDSEGNQNSVSVEQAEDWHIAGVSQTGDNNTDNVVQTGFFNQSDAVTAGNGNAVDVMQAGDQNASNVELTGDNNSAWVDQDGSSNYAVFRVQGNDNDGEITQLGNNNQGGLIA
LDFTANVGNNNDVSIYQEGDDNVGGVRGVAGDNNEVEIEQVGNNNVGFVYALQGSNNDLTMTQDGDRNVAVLEFTTGDNNDVEINQSGSENAIGDSLIAVIEGSDNMIDIEQEGFSNSAQFIVDGDDNDVDLEQEGDLNYAEFVAVGNDNTLNLSSEGNGNQLLAGAFGEDNSLEVAQEGDVNYAYSVAF
GNDNEVDIAQMGNDNEAIVTIEGNNNTDIIGTQSGDLNVLDLLIQGDENLAQITQTGNGNWVGGDAGAFAVVGEGNSFIVAQSGNDNLVTGAQMGSSNVINVTQVGNENVATVIQNGAPR
Molecular weight: 52.15 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A1S1G8|RL34_SHEAM 50S ribosomal protein L34
MSKRTFQPSNLKRKRSHGFRARMATANGRKVLARRRAKGRARLSA
Molecular weight: 5.18 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,614 |
24 |
3,638 |
1,251,457 |
34 |
4,214 |
346.3 |
38.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.21 |
1.04 |
5.68 |
6.07 |
3.94 |
7.63 |
2.23 |
5.29 |
4.49 |
11.23 |
2.66 |
3.56 |
4.2 |
4.27 |
5.24 |
6.27 |
5.01 |
6.89 |
1.28 |
2.81 |
Note: For statistics only major isoforms were used (in this case 3,614 proteins)
For dipeptide frequency statistics click
here