Hepatitis delta virus genotype I (isolate D380) (HDV)
Average proteome isoelectric point is 9.06
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P29996|LHDAG_HDVD3 Large delta antigen
MSRPEGRKNRGGREEVLEQWVSGRKKLEELERDLRKVKKKIKKLEDEHPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPSRGGFTDKERQDHRRRKALENKRKQLSAGGKNLSKEEEEELRRLTEEDERRERRIAGPQVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFTRTGEGLDIRG
SQGFPWDILFPADPPSSPQSCRPQ
Molecular weight: 24.06 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P0C6L3|SHDAG_HDVD3 Small delta antigen
MSRPEGRKNRGGREEVLEQWVSGRKKLEELERDLRKVKKKIKKLEDEHPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPSRGGFTDKERQDHRRRKALENKRKQLSAGGKNLSKEEEEELRRLTEEDERRERRIAGPQVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFTRTGEGLDIRG
SQGFP
Molecular weight: 21.94 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2 |
0 |
2 |
409 |
195 |
214 |
204.5 |
23.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.67 |
0.24 |
5.38 |
12.22 |
2.2 |
13.69 |
0.98 |
2.69 |
10.27 |
7.09 |
1.47 |
2.44 |
3.91 |
7.58 |
12.96 |
5.13 |
2.93 |
3.91 |
1.22 |
0.0 |
Note: For statistics only major isoforms were used (in this case 2 proteins)
For dipeptide frequency statistics click
here