Virtual 2D-PAGE plot for 2,551 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|Q18E34|Q18E34_HALWD Probable biosynthetic carrier protein ArgW
MVETIMGEDPLTGEEIEIPANVEVGEIVDSPATGAELEIVATDPLTLEEAPELEEDWGE
Molecular weight: 6.32 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|Q18E80|Q18E80_HALWD ABC-type transport system permease protein (Probable substrate biotin)
MIQYDPGTTIIHQLDPRTKLFVQATVAALAFAHTTPRGLIVLSGFAISCVIMSNLSFRRAISAARPALPFLIAAPVVTAIDISSWPPEIVPAAAIGASLASYRVIIIFIIAAVYLHTTPIRQSQAAIQWFVPGRVGRLLALGVSVVFRTLPVIRADIHRVRSAAKARLIQNQTRRERVRIIGTAGLRRTF ERADRLTLALQARCLAWNPTLPRLVFGRADGVALIFIIITAMFLLII
Molecular weight: 25.96 kDa Isoelectric point according different methods: