Salinibacter ruber (strain DSM 13855 / M31)
Average proteome isoelectric point is 5.74
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,812 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q2S2Q1|Q2S2Q1_SALRD Uncharacterized protein
MTLAFVSLVAITLGIVLVFGLGFGAMYVLWTLLQPPETPDDSEEG
Molecular weight: 4.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q2S5D5|Q2S5D5_SALRD Translation initiation factor IF-2
MSRFRQRRPRRARLVTIRHRALPEGPRRAPETWRPVCGDVRRCSVSLPHSGHDPRPPPNGRPPLGGRCPPDGAVVGGRPVCLRPVPGQRAGRGTLVRERPGDARRGRPAAGNRPAGGVGRVPTGRSRVDGNAGVLAPQRRVLPLRGRVQQPVSRLRRPGCAFRHGAGVRPPVDRRNGPAQTGAAGPSRSM
DRRLSGGGGRDTGGTLRGLLAPACRHRPGARAARRDGAAGPPGCGPPPDDGGTGGVVGGIVALATTPVGLRVGHALGRGGRRLHAVPLRRHRRGRGGWPVNHLDAASPLGSHRGRLRPCRRRATAGAAPRFADPMSTDARPTARTEPSRRPGRSLATPPAPAGRAPPPAHR
Molecular weight: 37.96 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,770 |
42 |
2,812 |
992,673 |
30 |
2,597 |
358.4 |
39.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.72 |
0.68 |
7.0 |
7.01 |
3.39 |
8.37 |
2.22 |
3.7 |
2.1 |
9.7 |
1.91 |
2.45 |
3.55 |
5.66 |
7.72 |
5.84 |
6.22 |
7.87 |
1.26 |
2.62 |
Note: For statistics only major isoforms were used (in this case 2,770 proteins)
For dipeptide frequency statistics click
here