Aureobasidium melanogenum CBS 110374
Average proteome isoelectric point is 6.5
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,583 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A074W6D6|A0A074W6D6_9PEZI Uncharacterized protein
MLLDTDELLEDDRLELALLELLDDADDDDEDEKDDEDELLADEVAEARPAEDDTEDDTEDEEDEESEDETLELLDDEALDDDEDEDDEEDDEDELLADEVTEAKLAENATEDDMELETLELPDDEALEDEEEEDEDDDDDDEEDDEDELLADDVMEANLAEDETKDEMELETLELLDDEALEDEELLEDD
RLELTELLELLDEDDDEDDELLEADMEATPAEEEAEDDNEDETLELLDDEALDDDELDRLELTLELLELDEEDELLDETEANIEAAPADDEIEDDIDDELEELALELLLLDKEDELLLLALELDELELDEEELLLDIDAVICAARLLTEDEVDDEAEDDELDDTELELLEESELLDDEDTLDEELLKLEL
EEDEDDAELREDDKDEDDDEDDEDEDDDEDDALDDEELEDEELDEVKEI
Molecular weight: 49.49 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A074VTV7|A0A074VTV7_9PEZI 60S ribosomal protein-like protein L39
MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI
Molecular weight: 6.31 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,582 |
1 |
10,583 |
4,695,994 |
49 |
4,913 |
443.8 |
49.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.83 |
1.27 |
5.8 |
6.08 |
3.73 |
6.48 |
2.42 |
4.94 |
5.07 |
8.84 |
2.25 |
3.87 |
4.2 |
5.75 |
5.77 |
8.25 |
6.09 |
6.07 |
1.46 |
2.84 |
Note: For statistics only major isoforms were used (in this case 10,582 proteins)
For dipeptide frequency statistics click
here