Flavobacteria bacterium (strain BBFL7)
Average proteome isoelectric point is 6.1
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,592 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q26AY7|Q26AY7_FLABB Uncharacterized protein (Fragment)
MNGSDPTDPCSVSGTATIPDVSDANYAVWAAADCDGDGETNGEEVMNGTEPFDPCSVTNPTIPAPTDENYAVWAAADCDGDGDSNGTDPAPNDPCVFTAGSVADTSNPIWQAADCDGDGDSNGTDPDPADPCVFTAGSTADTSNAIWAAADCDGDGDSNGTDPDPADPCVFTAGSTADTSNPIWQAADCD
GDGETNGTEDMNGSDPTDPCSVSGTATIPDVSDANYAVWAAADCDGDGETNGEEVMNGTEPFDPCSVTNPTIPAPTDENYAVWAAADCDGDGDSNGTDPAPNDPCVFTAGSVADTSNPIWQAADCDGDGDSNGTDPDP
Molecular weight: 32.87 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q26B37|Q26B37_FLABB 50S ribosomal protein L20
MPRAKNRVASRARRKRVLKQAKGYFGRRKNVWTVAKNAVEKAMSYSYRDRRNKKRTFRALWITRINAGARMHGMSYSQFMGAVKKNDIELNRKVLADLAMNHPEAFEAVVNKVK
Molecular weight: 13.31 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,584 |
8 |
2,592 |
926,131 |
88 |
4,500 |
358.4 |
40.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.75 |
0.75 |
6.33 |
6.24 |
4.84 |
6.49 |
1.88 |
7.79 |
6.56 |
9.1 |
2.37 |
5.99 |
3.73 |
3.43 |
3.62 |
6.59 |
6.12 |
6.31 |
1.04 |
4.09 |
Note: For statistics only major isoforms were used (in this case 2,584 proteins)
For dipeptide frequency statistics click
here