Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Average proteome isoelectric point is 6.27
Get precalculated fractions of proteins
Acidic |
![](../download.png) |
pI < 6.8 |
![](../download.png) |
6.8-7.4 |
![](../download.png) |
pI > 7.4 |
![](../download.png) |
Basic |
![](../download.png) |
All |
![](../download.png) |
Virtual 2D-PAGE plot for 2,752 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q0VTL5|Q0VTL5_ALCBS Hypothetical secreted protein
MLHLTRLLLLFTFMAVLTACGDGGGSSSSGSTSTNQETGNTGSGDTGGGDTDGSDTDSGDTDGGDTGGGDEDDTVPPVTEEEEAQLLTLIDTNNHFTVSVCPQALLGTQLGGAIDVLTCENEALENISLGNDNLLGLLCADTVAATESNLLSSATNPDFLQNCLLESGAYLKDTLTGLLDNSGPIGQQLC
PSSTNPIECIIETVNTVPDSTLIGVLGYLGCEDSLNPQVCLSQVAENLSKGEPLISTVNSLSTALCPISTRADNFQPQACLTEVLGGVGSILNLSGGLGELCPEDADPLTCLLAAGEKLGPVGDLLGGGTINPGILTDLLAGLAEPGNLALLETLPTLLEQIPVLGDLLAGLLNNGGDLFAPLKDLQTLP
ELLTQLPILGDLLNGIAGGDSGGLPTDALDLESLLNGLSGDQLTVVTDLLAEIPVLGNVIDQLLGAVACESGSPLDCLTQSAGQLGQFGDLLTEVPLLGDLLEPLLATLTGVASGGELLAGVDLLNEVPVVGDLLNQILTVLQGGAGDSLLTPDLAMLIEQPALQGLLDSLLGGLVGGLAGGDPSQLLNG
ILDQDGNLLDAVIGLVQSLPIVGDLVGSLLVSLLGENAAGSLLAPLSDVLADIPVLGPVLGGLLGGLLG
Molecular weight: 64.07 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q0VKU5|RL34_ALCBS 50S ribosomal protein L34
MKRTFQPSVLKRKRAHGFRARMATKNGRKILAARRAKGRKRLAA
Molecular weight: 5.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,699 |
53 |
2,752 |
889,634 |
33 |
3,600 |
329.6 |
36.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.05 |
0.99 |
5.82 |
6.05 |
3.64 |
7.76 |
2.34 |
4.94 |
3.83 |
11.12 |
2.64 |
3.35 |
4.55 |
4.71 |
6.17 |
5.75 |
5.07 |
7.22 |
1.45 |
2.56 |
Note: For statistics only major isoforms were used (in this case 2,699 proteins)
For dipeptide frequency statistics click
here