Citrus psorosis virus (isolate Spain/P-121) (CPsV) (Citrus ringspot virus)
Average proteome isoelectric point is 6.14
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 4 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q6DN66|VP24_CPSVP Uncharacterized 24 kDa protein
MAEYIEVRVENLHKWGLEINMERIEKLSKRLKSIVDEDCIMKTSRIIGIWMFMPEIVQESLKDSPLMTQKAWIIPHEKTYKTIYGKDGIQMAVTQNEEDLFKDSEFFMISRCDSVMLTKNNKTIILNKELLNCNMSEDMLFNMLSCQEQDITEELMKKMKTIISSNPKERLEDKTEEVFWNSTRILNWIQ
HNDNSRSNSSDNSFRE
Molecular weight: 24.43 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q6DN64|NCAP_CPSVP Nucleoprotein
MSIPIKVSQLIDAKTKWESEKEKSPAEILTLLKTYGVLRDTGALSSKSTAFLSGLSKDKRVILTDEGLAEFKSVENPHDQGEKPAFTLASSSSIKITNIEVIKQKMEQETFQIDQLKLKEQIENFIKTVTLDDESYTEGEIIIKHFGNPDAELNMLITAGTKILDGLVYVSMKGDTKSLNLFKMEQVDGV
CDSDIIKNIRVAKRAIQAAFVLIFTQGSLPGKADDKRKVPEFVKSKLYDGDVSLSQISEELSHAPTKKFPARVFLKIDIDNLPSAVCSRCKLNIAGNRSVRYAGFASSFQTKQKLSPAVGATPESLMPLLETNQKIEKSIAIRDFLKTMEGQWKNQKRLHPLSDEKPTIKNFTLKLTCAIIYSLTPDGRI
DMAERIITDKNKGFQNDRNFFGDGEGPTRTWSVLTKPEADFSNITVDGLKGIFGVASTM
Molecular weight: 48.76 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4 |
0 |
4 |
3,537 |
206 |
2,416 |
884.2 |
101.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.76 |
1.16 |
5.97 |
9.02 |
4.01 |
4.89 |
1.41 |
9.36 |
9.87 |
9.08 |
3.9 |
5.91 |
2.77 |
2.29 |
4.47 |
7.89 |
5.15 |
4.89 |
0.88 |
3.31 |
Note: For statistics only major isoforms were used (in this case 4 proteins)
For dipeptide frequency statistics click
here