Virtual 2D-PAGE plot for 9 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>sp|P0CK40|REP_BGYMJ Replication-associated protein
MPPPQRFRVQSKNYFLTYPRCTIPKEEALSQLQKIHTTTNKKFIKVCEERHDNGEPHLHALIQFEGKFICTNKRLFDLVSTTRSAHFHPNIQGAKSSSDVKEYIDKDGVTIEWGQFQVDGRSARGGQQSANDSYAKALNADSIESALTILKEEQPKDYVLQNHNIRSNLERIFFKVPEPWVPPFPLSSFV NIPVVMQDWVDDYFGRGSAARPERPISIIVEGDSRTGKTMWARALGPHNYLSGHLDFNSRVYSNSVEYNVIDDISPNYLKLKHWKELIGAQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYKDFLNKEENRALHNWTIHNAIFVTLTAPLYQSTAQDCQT
Molecular weight: 40.23 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>sp|P0CK36|REN_BGYMJ Replication enhancer protein
MDSRTGENITAHQAENSVFIWEVPNPLYFKIMRVEDPAYTRTRIYHIQVRFNHNLRKALDLHKAFLNFQVWTTSIQASGTTYLNRFRLLVLLYLHRLGVIGINNVIRAVQFATNKSYVNTVLENHDIKYKFY
Molecular weight: 15.63 kDa Isoelectric point according different methods: