Bovine papillomavirus type 3
Average proteome isoelectric point is 5.85
Get precalculated fractions of proteins
Acidic |
![](../download.png) |
pI < 6.8 |
![](../download.png) |
6.8-7.4 |
![](../download.png) |
pI > 7.4 |
![](../download.png) |
Basic |
![](../download.png) |
All |
![](../download.png) |
Virtual 2D-PAGE plot for 8 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q8BDD8|VE7_BPV3 Protein E7
MKGQDVTLKNVAVELEDVVSPIILDCEEEIETEEVDCPAPYAVEAVCYVCENPLRLALVSSPDGIHQLHQLLLDCISLLCANCSREVYSNRRPQRNGP
Molecular weight: 10.88 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q8BDD6|VE2_BPV3 Regulatory protein E2
METLQARFDAVQEQLLEIYEQDTSSLDVQITYWTLIRHEQALYYYARRQGILRLGIYQVPPTGVSEKKAKDAIKMTLFLKSLQKSEFAAQPWSLPETSLERFLAAPENTFKKRGQHVTVIYDKDSMNAMEYTLWTEIYAVDDNDQWHKYTSGVDYDGIYFTDAQGNKNYYVSFADDAALYSKLGHWEVQY
ENQVLSPPVTSSLPPGPNRRRGPQTRGHPRHKSASFRRSASSGSDTRDSRGRSRSPSSSRSRSRSRSRSPSGSHSRPRAPHVPDQETGRPPGGGGRRGSRDQQQGPGGPAPPSPGEVGTRSGPPETKAKGRLAELISAAYDPPVLLLQGCANTLKSFRRRTTQSYPHTFLCMSTSWTWASKTCTVKSGHR
MLVAFVNSEQRTLFLATVKIPKGVTCLKGSFDGL
Molecular weight: 46.29 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8 |
0 |
8 |
2,462 |
75 |
613 |
307.8 |
34.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.13 |
1.83 |
6.21 |
6.13 |
4.43 |
6.5 |
2.44 |
4.91 |
4.51 |
9.34 |
1.79 |
4.26 |
4.1 |
6.86 |
6.5 |
7.8 |
6.3 |
5.56 |
1.5 |
2.88 |
Note: For statistics only major isoforms were used (in this case 8 proteins)
For dipeptide frequency statistics click
here