Hylemonella gracilis ATCC 19624
Average proteome isoelectric point is 7.12
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,342 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F3KY50|F3KY50_9BURK YapH protein (Fragment)
STTGAANLTAGGNLVVSGVFGNSLTTTTTNSGTTEFGTTSATSLDVTSAGAVTDTGNLSIMGTTTLAAGANAITLDESNDFGGTVMITSAGAVTLKDVDDLTVVSTSTTGAANLTAIDNLVVSGVFGSNLTTATTGTGTTSFGLTSVGGVLDVESANAVGQTGALSVTGTSSIDAGSATVILNISSNNFG
GAVSLTGGITQITDANALTLGALNTGALTVITTGNLDLGSGTISGALNVTSNNGAVTQAGALSVTGLSTLNAGTGAITLGNTGNDFVDTVTITSAGALTLQDQNALTVVSTLTTGAANLTAGGNLVLSGMFGSSLTTTTTGTGTT
Molecular weight: 31.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F3KQX7|F3KQX7_9BURK 50S ribosomal protein L35
MPKMKTKSAAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRHLRGAVNVHATNMGHMAQMLPGQGL
Molecular weight: 7.52 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,327 |
15 |
3,342 |
1,078,888 |
20 |
1,969 |
324.3 |
35.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.77 |
0.82 |
5.07 |
5.35 |
3.33 |
8.28 |
2.27 |
4.23 |
3.29 |
11.31 |
2.39 |
2.54 |
4.36 |
5.23 |
6.92 |
5.39 |
5.15 |
7.55 |
1.49 |
2.24 |
Note: For statistics only major isoforms were used (in this case 3,327 proteins)
For dipeptide frequency statistics click
here