Tetrahymena thermophila (strain SB210)
Average proteome isoelectric point is 7.15
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 26,976 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q241P4|Q241P4_TETTS Transmembrane protein putative
MRKQFIVLLLISLLLTAALGRGLRKEKPIQKSHSAVSKETEMTENTPKLIQDDEENADEGDNGDDEESGDSDDDSGDSDDEESGDSDDEESGDSDDQESGDSDDEESGDSDDEESGDSDDEESGDSDDDNGDSDDDNGDSDEDNGDDDSNDDDNGDDENGDDAEDGDDAEDGDDAEDGDDAEDGDDAEDG
DDAEDGDDAEDGDDAEDGDAAEDGDDAEDGDDAEDGDDNEDAEDGDDAEDGDDAEDGDDNEDGDDAEDGDDAEDGDDAEDGDDNEDAEDGDDAEDGDDAEDGDDAEDGDDNEDGDDNEDGDDEEAQDQSELIQKNKKQQVLDSN
Molecular weight: 35.16 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W7XBT5|W7XBT5_TETTS Caspase recruitment domain 15 protein (Fragment)
TQMGRKQLLPKQLNVLISPLQASTLGLIIQIQMGRKQLLPKQQNVLISPLQASTLSLINLIQMGRKQLLPKQLNVLISPLQSLTLGGIKQVQMGRKQLLPKQLNVLISPFQAQTFRLIIQIQMGRKHLLPKQLNLLISPLQASTF
Molecular weight: 16.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
26,971 |
5 |
26,976 |
16,913,569 |
27 |
8,271 |
627.1 |
72.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.26 |
1.79 |
4.84 |
5.96 |
5.18 |
3.47 |
1.44 |
8.63 |
8.76 |
9.19 |
1.79 |
9.18 |
9.62 |
2.59 |
2.71 |
8.32 |
4.4 |
3.98 |
0.51 |
4.31 |
Note: For statistics only major isoforms were used (in this case 26,971 proteins)
For dipeptide frequency statistics click
here