Ostreococcus lucimarinus (strain CCE9901)
Average proteome isoelectric point is 6.55
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 7,403 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A4SB31|A4SB31_OSTLU Uncharacterized protein (Fragment)
MTQVPVISSASSEPSSPVPGETPNAYPTQSPVPGETPNAYPTQSPVPGEAPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPV
PGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPAPNAYPTPSPNAYPTQSPVPGEAPNAYPTPSPNAYPTPSPSAYPTPSPE
Molecular weight: 35.96 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A4RXX4|A4RXX4_OSTLU Uncharacterized protein
MRAQRGALVVTAGGKSIGCTLGGTRRKRARTSGFRTRIASASGRKVLKNRRAKGRKVLAPAGAVRGWNKEKK
Molecular weight: 7.72 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7,403 |
0 |
7,403 |
2,987,645 |
35 |
18,193 |
403.6 |
44.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.9 |
1.68 |
6.38 |
7.04 |
3.55 |
7.16 |
1.96 |
3.91 |
4.91 |
8.42 |
2.4 |
2.99 |
2.65 |
4.23 |
7.46 |
6.73 |
5.7 |
7.35 |
1.22 |
2.35 |
Note: For statistics only major isoforms were used (in this case 7,403 proteins)
For dipeptide frequency statistics click
here