Methanobacterium sp. MB1
Average proteome isoelectric point is 6.1
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,013 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|U6EF89|U6EF89_9EURY Putative secreted protein
MKKPKFTEKIKTEAVVASFLLVFLIGCGLVFISGHESTADTTAIPSGPVAQSNPLPGNETPTIEGSTYAPGSQSGGYWYLVKIPGKILTSISGYYRTPSELSGTAVNAADQISETPESGSINIEQGENGELILVDDNGEIVDWNDLPEDVRADLIRLFPELFDDIQNQTSDDNETTENNETGDNETEEDP
FDYPEAEEEDLNLSDIEQGDDNGFSDDFDDELNPDDQNQTGNETPENGDDQDESNSTIETGNDEVGEVEEVDPTEDEEEFPEDVPDDLPDEEWIDDWING
Molecular weight: 31.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|U6EEB8|U6EEB8_9EURY Tetrahydromethanopterin S-methyltransferase subunit F
MLISNKPNIRGIKKVAADVKYRTQLIGRDQRLFSGLIATRIYGMAIGFILAALLIGIPVIWALLASQGA
Molecular weight: 7.48 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,011 |
2 |
2,013 |
559,255 |
29 |
2,654 |
278.1 |
31.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.44 |
1.2 |
5.62 |
7.65 |
3.88 |
7.1 |
1.9 |
8.35 |
7.09 |
9.56 |
2.83 |
4.49 |
3.15 |
4.08 |
4.1 |
5.94 |
5.23 |
7.19 |
0.81 |
3.4 |
Note: For statistics only major isoforms were used (in this case 2,011 proteins)
For dipeptide frequency statistics click
here