Virtual 2D-PAGE plot for 47 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>sp|P03254-2|E1A_ADE02 Isoform of P03254 Isoform early E1A 26 kDa protein of Early E1A protein
MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGPVSEPEPEPEPEPEPARPTRRPKLVPAILRRPTSPVSRECNSSTDSCDSGP SNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNESGQPLDLSCKRPRP
Molecular weight: 26.45 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>sp|P14269|COR10_ADE02 Pre-core protein X
MALTCRLRFPVPGFRGRMHRRRGMAGHGLTGGMRRAHHRRRRASHRRMRGGILPLLIPLIAAAIGAVPGIASVALQAQRH
Molecular weight: 8.85 kDa Isoelectric point according different methods: