Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Average proteome isoelectric point is 6.38
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 5,353 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A7TSG4|A7TSG4_VANPO Putative uncharacterized protein
MAASVDDVSTTTPSLDEVSTMAASVDDVSTTTPSVDEVSTMTPSVDEVSTMAASVDDVSTMTASLDEVSTMAASLDDVSTMAASLDDVSTTTPSVNEVSTMTPSVDDVSTMAASVDEVSTTTPSVDEVSTMAPSLDDVSTMAPSLDDVSTTAASLDDVSTTTPSVDEVSTMAASLDDVSTTTPSVDDVST
TTPSLDEVSTMTPSVDEVSTMTPSVDDVSTMTASLDDVSTMAALLDEVSTMAASLDDVSTMAASLDEVSTMAASLDDVSTTTPSVDEVSTMAASLDDVSTTTPSVDDVSTTTPSLDEVSTMTPSVDDVSTMTASLDDVSTMAALLDEVSTMAASLDDVSTMAPSLDDVSTMAPSLDEVSTMAASLDDVST
MAASLDEVSTMAASLDEVSTMTPSVDEVSTMAASVDDVSTMTASLDDVSTMTALLDEVSTMAASLDDVSTMAPSLDDVSTMAPSLDEVSTMAASLDEVSTMAASLDDVSTMAASVDDVSTTTPSLDEVSTMAASLDDVSTMAPSLDDVSTMAASLDDVSTMAASVDDVSTMAASLDDVSTMAASVDDVST
TTPSLDEVSTMAASLDEVSTTTPSVDDGNLVVKLTSAFID
Molecular weight: 61.65 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A7TLB6|A7TLB6_VANPO Putative uncharacterized protein
MRAKWRKKRVRRLKRKRRKVRARSK
Molecular weight: 3.34 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,313 |
40 |
5,353 |
2,687,752 |
13 |
8,837 |
505.9 |
57.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.68 |
1.1 |
6.02 |
6.88 |
4.26 |
4.9 |
1.95 |
7.03 |
7.25 |
9.1 |
1.96 |
6.75 |
3.63 |
4.01 |
3.9 |
9.46 |
6.76 |
5.79 |
0.95 |
3.6 |
Note: For statistics only major isoforms were used (in this case 5,313 proteins)
For dipeptide frequency statistics click
here