Virtual 2D-PAGE plot for 1,407 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0R2JP29|A0A0R2JP29_9LACO Uncharacterized protein
MEVEAEKLVETLALFDALELEALVEALSLASELLSDFAAELLVLSDADALSDTLVEADALSLTELDSLLLVSLSLACDSLSDCDALLVEALADSLFEVLSLSEILVEALADSVVDSDPWSDADLLLEALSELEAEVLADSDPLFTVDSLSLVLLASDELVEAEADELVEPLLSFPDAEVLTESLVLLAAE SLALALVEADLLALSESVPEPLIEAESLSLFLVESLIEVLMEALSLALFEALELEVLVEVLVESLVEALSLALVEALELEALVDSLSLAAELLSDFAAELLVLSDADALSDALVEAESLSLTELDSLLLESLSLVLVEAD
Molecular weight: 34.79 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0R2JM38|A0A0R2JM38_9LACO 50S ribosomal protein L34
MKRTYQPKKRHRNRVHGFRARMQTKGGRKVLARRRQKGRKVLSA
Molecular weight: 5.33 kDa Isoelectric point according different methods: