Candidatus Kaiserbacteria bacterium GW2011_GWA2_49_19
Average proteome isoelectric point is 7.46
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 581 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1VNF9|A0A0G1VNF9_9BACT Uncharacterized protein
MVQLVLLRVCPDGPVGPVNPVEPVGPVGPVGPLIPVGPVGPVGPEMPVGPVGPVGPLLPDGPVGPVSPVAPVGPVAPVGPVTPVAPVGPVGPVCPEGPVGPVGPLIPVGPVGPIEPVAPVGPVGPVWPEGPVGPVGPVIPVAPVGPVGPVCPEGPVGPVGPVIPVDPVGPVGPLLPVGPVGPEIPVGPVG
PVGPLIPVGPVGPVGPVTPVAPVGPVGPVIPLGPVGPVGPVKPVEPVGPVGPLIPVGPVKPVAPEGPVGPVAPSVPAGPGAPVGPVGPVGPLIPVGPVGPVGPVGPLLPVGPVGPVAPLIPVGPVGPVGPVWPEGPVGPVGPVIPLGPVGPVGPVSPVAPVGPVGPLTPVGPVGPVTPVAPVGPVGPVCP
EGPVGPVAPLMPVGPVGPVGPLIPVGPVGPVAPLIPVGPVGPVWPEGPVGPVEPVGPLNPVGPVGPVGPVIPVAPVGPVGPVCPEGPVGPVGPVNPVDPVGPVGPLLPVGPVGPVMPVAPVGPVGPVCPEGPVGPVGPVNPVAPVGPVGPVGPVIPVAPVGPVGPVCPEGPVGPVGPVAPLIPVGPVGPV
GPVWPEGPVGPVGPLIPVGPVGPLIPVGPVGPVTPAPPLAPVISFQTVPLQ
Molecular weight: 57.33 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1VP37|A0A0G1VP37_9BACT Uncharacterized protein
MPLEVKRQGRETSQTLVRRFGQRIQRSGLLIRARRKRFKLRTKSDEGKKREALRREELKKQYRKLEKLGKLPPRSRKRRRR
Molecular weight: 10.01 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
577 |
4 |
581 |
170,505 |
34 |
3,717 |
295.5 |
32.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.86 |
0.86 |
4.79 |
6.44 |
4.46 |
7.75 |
1.82 |
6.69 |
6.88 |
9.26 |
2.2 |
3.87 |
3.14 |
4.34 |
5.34 |
6.23 |
5.55 |
7.39 |
1.09 |
3.03 |
Note: For statistics only major isoforms were used (in this case 577 proteins)
For dipeptide frequency statistics click
here