Marinobacter nanhaiticus D15-8W
Taxonomy: cellular organisms; Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales; Alteromonadaceae; Marinobacter; Marinobacter nanhaiticus
Average proteome isoelectric point is 6.05
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 4,732 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|N6WW54|N6WW54_9ALTE Uncharacterized protein
MKSQKNLLALAIAMSLGLSGTALAQQGGDGDPNVNADNTSNANNGYSGNTDSGNDNSNNSDNSDNSDSSDNSATATDSFKIADSGNDMSDNSDNSDNSDSSDNSTNVNDAFKIADSGNDMSDNSDNSDNSDSSDNSTNLDVADSGNDMSDNSDNSDNSDNSDNSDSSDNSTNVNDSFKIADSGNDMSDNS
DNSDNSDNSTTTTTLELDVFLNNADLDGTVSGITTTYGDANAEGAYTTASHHNEISGGSANFTGVGAFAQNNGTGAVTQANVSVMSNLSTNGGGSTGTR
MKSQKNLLALAIAMSLGLSGTALAQQGGDGDPNVNADNTSNANNGYSGNTDSGNDNSNNSDNSDNSDSSDNSATATDSFKIADSGNDMSDNSDNSDNSDSSDNSTNVNDAFKIADSGNDMSDNSDNSDNSDSSDNSTNLDVADSGNDMSDNSDNSDNSDNSDNSDSSDNSTNVNDSFKIADSGNDMSDNS
DNSDNSDNSTTTTTLELDVFLNNADLDGTVSGITTTYGDANAEGAYTTASHHNEISGGSANFTGVGAFAQNNGTGAVTQANVSVMSNLSTNGGGSTGTR
Molecular weight: 29.27 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|N6VYJ1|N6VYJ1_9ALTE 50S ribosomal protein L34
MKRTFQPSVLKRKRVHGFRARMATANGRKVIARRRAKGRARLSA
MKRTFQPSVLKRKRVHGFRARMATANGRKVIARRRAKGRARLSA
Molecular weight: 5.09 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
1,528,259 |
23 |
5,348 |
325.8 |
36.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
9.96 |
0.91 |
5.99 |
6.58 |
3.77 |
7.82 |
2.24 |
5.25 |
3.43 |
10.63 |
2.53 |
3.15 |
4.06 |
4.74 |
6.64 |
5.83 |
5.19 |
7.23 |
1.4 |
2.65 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |