Methanolacinia petrolearia (strain DSM 11571 / OCM 486 / SEBR 4847) (Methanoplanus petrolearius)
Average proteome isoelectric point is 5.63
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,779 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E1RFM3|E1RFM3_METP4 PKD domain containing protein
MYDNVELNKRSILKSFLSGSTGKFALLVLLVLISFPLICTPAAADSASASGLNVAMTLSSGDDWDGYLVLTYSGTVSGKTASSWSWSFDDSDTATGSSGTHTYDETGTYDVILVVTYSDSTTEQIATDIAIEEPTLDASADITVDDDDLKITYESTTDGAVSWEWDFDDGDTSTSESGSHYYDDYGEYTV
TLTVTSEDSSTDTYTEDITLDESPSAYFTVDVDSGSSPLTVEFTDGSEENSYTGADIVEWVWDFDYDDETETFDDDDSSADTEFTFEEEGTYTVTLTVTDEDGEEDSYEMDIVVDDDSAPTADYYIDDDCDTSGAATLTIQFYDDSEEAEDTGAEITSWLWKFYDEDDSLYLYSYSENPELDFEDEGVYT
LVYTVTDEDGVSDSMTEEDLIEVYSGLSVTFYGSPTSGTTPLTVYFYATDGAYNEYDIETYYWYFGDGSTSSESDTSTSHTYKTAGTYDVKLKVTDEEGNTYTCTESDYITVSTAATSVATSSKTYAVTESATSAETEEADLGSSTSSGTTIFGIPGTEYFRTEMSRFYNFYEEYTSLLAGMFGMG
Molecular weight: 62.09 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E1RIK8|E1RIK8_METP4 50S ribosomal protein L39e
MSKVTKARKIRLAKACEQNRRVPAWVMIKTKRHVVSHPRRRNWRRSKLKV
Molecular weight: 6.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,767 |
12 |
2,779 |
823,066 |
30 |
2,645 |
297.5 |
33.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.24 |
1.35 |
5.98 |
7.47 |
4.26 |
7.89 |
1.55 |
8.43 |
5.72 |
8.67 |
2.71 |
4.08 |
2.15 |
4.12 |
4.52 |
6.96 |
5.32 |
7.0 |
0.95 |
3.61 |
Note: For statistics only major isoforms were used (in this case 2,767 proteins)
For dipeptide frequency statistics click
here