Pseudoalteromonas ruthenica
Average proteome isoelectric point is 6.19
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,470 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0F4PS38|A0A0F4PS38_9GAMM Curlin
MKLSKSILTCAIAMALSTGAYAQSEDKPGSTSALANVERAAAVGNELTISQTSVQGLGNSASSLQQGDANLTEITTVGDGNQTDAMQIGNGNVVLVTTQGDNNQQSYNQDGEANGALSEVTGSDNQIAVEQNGTGFLGINNEAINVIGGDANQINVVQGDGGHWFYNLDMQGNANVVNAQQAGLWNEAQF
TSVQGDANDLSVEQDGFWNQLSVTSINGSMNEFASEQLGDTNVISIGDIFGDENELAVEQEGANNSTDIVSIEGNENALSIDQEGSANTFESALFSGDGNELNVMQMGDNNAASAEVLGDENDFSATQNGSGNEVYLGVLGNNNEFDAMQIGNDNATHVVNFNGNDNDVAVAQSGDMNTAVIESSYPDPS
IASNDNDIAITQSGMGNEAVLTMGSVMESSSNQVDLVQSGELNAIDLMVEGSGHSIDIAQEGGMNMVAGMGQGAFAVAGEGNTVSISQLGEGNLVEGSVMGTGNTVAVTQVGDYNSATVVQQ
Molecular weight: 51.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0F4PYH2|A0A0F4PYH2_9GAMM 50S ribosomal protein L34
MKRTFQPSVLKRKRTHGFRARMASANGRKVLARRRAKGRKVLSA
Molecular weight: 5.08 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,465 |
5 |
3,470 |
1,145,516 |
34 |
2,488 |
330.6 |
36.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.57 |
1.01 |
5.66 |
6.03 |
4.01 |
6.69 |
2.53 |
5.68 |
4.78 |
10.51 |
2.4 |
4.02 |
5.59 |
3.84 |
4.77 |
6.44 |
5.09 |
6.93 |
1.21 |
3.24 |
Note: For statistics only major isoforms were used (in this case 3,465 proteins)
For dipeptide frequency statistics click
here