Alcanivorax pacificus W11-5
Average proteome isoelectric point is 6.43
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,686 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0B4XUM6|A0A0B4XUM6_9GAMM Uncharacterized protein
MNGIFARGALLGAVLFALAACGGGGGSSNNAGSGGNPPAEPASPATELTSTENEFTEAFCPSAVTGQVEGQISATDCQAEASSGIPGLNGNVLARFCPEAAEDFAVITHDDNGLTVLPMDFGPACLQELAGMLGNLEDLLGGDGGNPLLTALCPTASMSNEFNPADCLTEALSLGNGDLPGLSELTELVG
QIPVLGDIIGALMGGGLPGEFPGLDGLCDPTDPLGCLSALAELLNPLTDALDQVPVLGDLINGLLSGELPGGGLPGGGDLPGLDQLAGLLAPLTGLLGEIPVLGDVINQLLGALLGGGTPGGELPQLPGLGDLCDPADPLSCLAALSDLLGPLTGLLDQVPVLGDLINGLLSGELPGGGLPGGGDLPGLE
QLSELLAPLTGLVEEIPVLGDVVNGLLGALMGGGTPGELPGLPDLGELCDPTDPLSCLTALSDLLAPLTGLLDQVPVLGDLINGILSGELPGGGLPGGGDLPGLEQLSELLAPLTGLVGEVPVLGDIINQLLAPLLGGGTPGGELPDLGGLCDPADPLSCLGALTELLAPLTDAVAQVPVLGDVVNGLLD
ALLSGGTPALPGIPDLEALCGDAADPLQCLLSVEQLQPITDLLTQIPVVGDILDGLLGGVLGGGTGGGSGTPLDDLPILGPILGPILGGLFG
Molecular weight: 64.53 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0B4XSE4|A0A0B4XSE4_9GAMM 50S ribosomal protein L34
MKRTFQPSQIKRKRTHGFRARMATKNGRAVLNRRRAKGRKQLTV
Molecular weight: 5.24 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,673 |
13 |
3,686 |
1,224,184 |
33 |
13,341 |
333.3 |
36.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.22 |
0.96 |
5.96 |
5.72 |
3.48 |
8.17 |
2.35 |
4.44 |
2.54 |
11.47 |
2.44 |
2.78 |
4.25 |
5.08 |
7.34 |
5.32 |
5.19 |
7.32 |
1.48 |
2.49 |
Note: For statistics only major isoforms were used (in this case 3,673 proteins)
For dipeptide frequency statistics click
here