Loktanella sp. 3ANDIMAR09
Average proteome isoelectric point is 6.17
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,527 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q3BF93|A0A0Q3BF93_9RHOB Uncharacterized protein (Fragment)
EFDDLAEGEEATTTVTYTPQDDSGLPGDPVTVTLTVTGTNDGPVAVADDLGAGEDDANAVIGNVLGNDIDPEDDPLTVSAVNGDPNSVGVPVAADNGGTVTIAPNGTIAFDPSDDFEQLGEGETATTTVTYTVTDPDGAEDTATVTITVTGTNDAPVAIADTGVATPDAVQPLDNVLGNDTDPDLNDVLT
VGAVDGDPANVGQPVAGDNGGLVTINPDGSATFDPNGEFDSLAEGEEVTTTVSYTVIDGNGGEDTTTVTITVTGTNGAPVATNDPLTAGEDDPSGIIGNVLDNDVDPNGDPLTVAAVNGVPGDVGQPVDLPDGGTVTIAPDGTVTFDPAGDFDDLGEGEERTTTVTYTVTDPAGAEDTATVTITVTGTND
APVAVMDEFPVSEDQDPTTVIGNVLDNDSDPEG
Molecular weight: 41.15 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q3EQY2|A0A0Q3EQY2_9RHOB 50S ribosomal protein L34
MKRTFQPSNRVRKNRHGFRARMATKAGRNIINARRAKGRSKLSA
Molecular weight: 5.1 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,510 |
17 |
3,527 |
1,052,862 |
32 |
2,634 |
300.0 |
32.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.68 |
0.88 |
6.89 |
4.9 |
3.64 |
8.68 |
1.99 |
5.26 |
2.8 |
9.72 |
2.85 |
2.63 |
3.44 |
5.06 |
6.69 |
4.87 |
6.06 |
7.42 |
1.36 |
2.18 |
Note: For statistics only major isoforms were used (in this case 3,510 proteins)
For dipeptide frequency statistics click
here