Virtual 2D-PAGE plot for 7,528 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|D9W1A9|D9W1A9_9ACTN Predicted protein
MDSMDLIAGYAAYTTPEELAASEATDAPAITTTVTSSEICITITVGWGC
Molecular weight: 5.04 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|D9VPS2|D9VPS2_9ACTN Predicted protein
MVVTVRRSVVTTVAIVPRTPAVTTTVVGVRPTRVVMTTVVGVRPTRVVTTSVVASVAVVTTVVVTVRRTRVAMTVAGTVRRSVVTTVASVPRTPVVTTSAVASVAVVTTVAVTVRRTRVAMTVAGTVRRSVVTTVASVPRTPVVTTTVVGVRPTRVVMTTVGGSVAVVTTVVATVRRTRVAMTVAGTVRR SVVTTVASVPRTPVVTTTVVGVRPTRVVTTTVVASAGAVTTVVVTVRRTRVAMTVAVTVPRSVVTTVASVPRTPAVTTTAVGSAGAVTTVAVTAAASVVTTGATVVGTVVAAMTAVAIVAASAVTTAVTATSAPTATRSSGFRSTRTSPATRSTPMCARNS
Molecular weight: 35.3 kDa Isoelectric point according different methods: