Bluetongue virus 10 (isolate USA) (BTV 10)
Average proteome isoelectric point is 6.49
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 11 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P23065|VNS2_BTV10 Non-structural protein NS2
MEQKQRRFTKNIFVLDVTAKTLCGAIAKLSSQPYCQIKIGRVVAFKPVKNPEPKGYVLNVPGPGAYRIQDGQDIISLMLTPHGVEATTERWEEWKFEGVSVTPMATRVQYNGVMVDAEIKYCKGMGIVQPYMRNDFDRNEMPDLPGVMRSNYDIRELRQKIKNERESAPRLQVHSVAPREESRWMDDDEA
KVDDEAKEIVPGTSGLEKLREARSNVFKEVEAVINWNLDERDEGDRDERGDEEQVKTLSDDDDQGEDASDDEHPKTHITKEYIEKVAKQIKLKDERFMSLSSAMPQASGGFDRMIVTKKLKWQNVPLYCFDESLKRYELQCVGACERVAFVSKDMSLIICRSAFRRL
Molecular weight: 41.0 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P08363|VP8_BTV10 Non-structural protein P8
MLSGLIQRFEEEKMKHNQDRVEELSLVRVDDTISQPPRYAPSAPMPSSMPTVALEILDKAMSNTTGATQTQKAEKAAFASYAEAFRDDVRLRQIKRHVNEQILPKLKSDLSELKKKRAIIHTTLLVAAVVALLTSVCTLSSDMSVAFKINGTKTEVPSWFKSLNPMLGVVNLGATFLMMVCAKSERALNQ
QIDMIKKEVMKKQSYNDAVRMSFTEFSSIPLDGFEMPLT
Molecular weight: 25.6 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
11 |
0 |
11 |
6,470 |
229 |
1,302 |
588.2 |
67.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.13 |
1.07 |
6.2 |
7.31 |
3.96 |
6.0 |
2.27 |
6.94 |
6.0 |
8.25 |
3.54 |
3.82 |
3.77 |
4.06 |
7.11 |
5.63 |
5.21 |
6.75 |
1.25 |
3.74 |
Note: For statistics only major isoforms were used (in this case 11 proteins)
For dipeptide frequency statistics click
here