candidate division WOR_1 bacterium DG_54_3
Average proteome isoelectric point is 7.29
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,800 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S7XJR2|A0A0S7XJR2_9BACT Uncharacterized protein (Fragment)
MIYVFFGGQIIDSIPDLVLQKSPQEMLGWCVSSGDVNGDECDDIIAGAYCPGDIGKVYIFLGSESPDTLPDVILAGQSPEETFGGSVCALGDVNGDGYADVMVGTDIFSSKAYLYLGGSPMDSLPDLIITEGGSCVSFCGDLNGDSLSDIIVSQDHSYIYLGGTDMDSLPDLILSQEGSALSPCGDVNGD
GYDDVAVAYYFNDSVWVFFGGDPMDSIPDLMISDALDGEVFGWEVADCGDLNQDGFSDFIVGAPSGGGGRGLIYFGGDPADDVFDVQIDPPDALYTQFGCSICAGDLNLDGFLEITLGAWENA
Molecular weight: 32.79 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S7Y7P0|A0A0S7Y7P0_9BACT 50S ribosomal protein L34
MKRTFQPNKRKRKKNHGFLVRMRTKGGQRIIKHRRQKGRKRMAG
Molecular weight: 5.4 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,701 |
99 |
2,800 |
819,303 |
32 |
1,988 |
303.3 |
34.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.02 |
1.06 |
5.08 |
7.03 |
4.77 |
7.25 |
1.83 |
7.85 |
7.45 |
10.02 |
2.32 |
3.83 |
2.91 |
4.32 |
5.05 |
6.03 |
4.74 |
6.58 |
1.24 |
3.61 |
Note: For statistics only major isoforms were used (in this case 2,701 proteins)
For dipeptide frequency statistics click
here