Vesicular exanthema of swine virus serotype A48 (isolate Swine/United States/A48/1948) (VESV)
Average proteome isoelectric point is 7.07
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P89681|CAPSD_VESVA Capsid protein
MATTHTLLSFDNLEFLLHRKDLTDLYGKRCGTLNLVINPYELFLPDELDDDCCDDPFNCCFSDVYASIGTEYSYIDPPDLIYEEHCATNGTWPDGTPCEPILPPFTITGTHHYYATKPGEVVSGILSKLRVFLGSLLRSTADVNSNFTFRAESDGPGSTEIVTEEQGTIVQQQPAPAPTALATLATASTG
KSVEQEWMTFFSYHTSINWSTVESQGKVLYSQALNPSINPYLDHISKLYSTWSGGIDVRFTVSGSGVFGGKLAALLVPPGVEPIESVSMLQYPHVLFDARQTEPVIFTIPDIRKTLFHSMDETDTTKLVIMVYKNGADTKTTCSITVETRPSADFTFALLKPPGSLIKHGSIPSDLIPRNSAHWLGNRWW
SMISGFSVQPRVFQSNRHFDFDSTTTGWSTPYYIPIEITITAKVKGNNHWYHVIAHDKALVPGIPDGWPDTTIPSEVHASNGNFDYAKGFHDDKEIVNPANNNTHFKGTYICGTLSTIKDPEKAENQSESQKKSSTMYVATADLGDNKVKPQHKISSQKLVVYFDGPEKDLTMNATLSPLGYTLVDDQPI
GSNSSTVVRIATLPEAFTQGGNYPIFYVNKTNKGYFDKATTDCYNSQILMTSQRLAEGNYSLPPDSLAVYRITDSSSQWFDIGINHDGFSYVGLPDLPADLTFPLTSTFMGVQLARVKLASKVKVTRNSIK
Molecular weight: 77.48 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P89682|VP2_VESVA Protein VP2
MNYANFGLDFLNSVANAAVEGKKLDLASRGLQLRSRALDTERDFNYAKLAFERHKFDTNNDLRIYGDAMRIQALRAAGLRINPYSNGRQIYQDEADLANLHSYYSFYKTD
Molecular weight: 12.65 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
2,692 |
110 |
1,881 |
897.3 |
99.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.32 |
1.67 |
6.13 |
4.64 |
3.79 |
6.54 |
2.75 |
5.57 |
6.17 |
8.32 |
2.04 |
5.16 |
2.9 |
5.87 |
4.79 |
7.1 |
7.47 |
6.84 |
1.37 |
3.57 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here