Hibiscus green spot virus (isolate Citrus volkameriana /USA/WAI 1-1/2009)
Taxonomy:
Average proteome isoelectric point is 7.16
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 8 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|G8DPJ9|G8DPJ9_HGSV2 p39
MESFNYVTSADLVCSLSRFRDFYKERSASLSDDDVYADTTREYSAALDSTEFVDYNFQIFLLNGVPGGGKTKFVYENVEVRNSCVVVPFKALKDEYRKRGYRSFTQFRALPSVRSADILVIDEYTCVCYSVLVSLVYKLRPATVALIGDFNQCWIRDGEGFSMEPFVSTLVVNKYLSVCYRCPCPDVEFV
RNYLDLDITPGKCGSTCSCTGFNVETLVEGMTFDYRGEVALVFSGASKSYLESIGVSAVTVRSFMGKQADTVALFILKDHDIRLLGVSSLKLVAFTRHVSKLVVYSDMSHDDVVALIEGATESGEVVDHDNFQPAYEDSLEQYFDRLLRGDFYVL
Molecular weight: 38.8 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G8DPK4|G8DPK4_HGSV2 p23
MLGLPELRLRLRARGKGLDALIYDVFNICLKFIMKPHILIMYACLLVVVYNKGEAGDVIEKALKAYPRNPILKWAKTDYVRFIGILVGLPVIIDAPRSFQLLITGAVFVSTYILPPQTLSTYLLGFVSLHVYSKAKSVQLRIILLASFATYLVLSGIVDTEKFTGSGTVLGGAHGAPKLSEVPIPTVLND
PGPRIRSVEERLPVIKRGGSGGV
Molecular weight: 23.24 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8 |
0 |
8 |
4,327 |
47 |
2,645 |
540.9 |
60.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.08 |
2.84 |
6.61 |
4.92 |
5.78 |
6.52 |
2.24 |
4.76 |
5.18 |
9.59 |
2.75 |
3.03 |
1.85 |
3.98 |
6.24 |
7.79 |
4.37 |
10.19 |
0.88 |
4.41 |
Note: For statistics only major isoforms were used (in this case 8 proteins)
For dipeptide frequency statistics click
here