Rubidibacter lacunae KORDI 51-2
Average proteome isoelectric point is 6.43
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,455 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|U5DJV9|U5DJV9_9CHRO Hemolysin-type calcium-binding repeat (2 copies)
MAIILDTVGGNILLDNAFEDDFIYAFGGDDTIVLSDDGLGDTVFAGTGDDTIEISDRTGSNTIAGGEGVDTVDYSNLGESITLNSLGVAKESGGFDFIDSVEVFIGATGAGIVNTIDGSSIGIVANTAFLNVDLASESLILDGLPDGPLSVTVQNFDNVIGTQNDDIIRGDSGTNEFSGDEGDDALFGDG
GDDTLDGGGGNDTLRGADNGQGEVDELTGGSGSDEFILGDAISGPLYVGGGDTDFARITDFESVDTLAFDPNTPFIDIPGTLGLGLGDREYYWDLNANGILDGVDDLFAVVDFA
Molecular weight: 31.11 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|U5DND9|U5DND9_9CHRO 50S ribosomal protein L34
MAQQTLRGTRLKQKRKLGFRARMRTKTGRRVINARRSKGRARLSV
Molecular weight: 5.3 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,418 |
37 |
3,455 |
1,046,929 |
24 |
13,395 |
306.3 |
33.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.76 |
1.14 |
5.78 |
5.96 |
3.77 |
7.66 |
1.84 |
5.17 |
2.73 |
11.24 |
1.68 |
2.99 |
4.18 |
5.33 |
7.08 |
6.0 |
5.42 |
7.15 |
1.49 |
2.65 |
Note: For statistics only major isoforms were used (in this case 3,418 proteins)
For dipeptide frequency statistics click
here