Formosa agariphila KMM 3901
Average proteome isoelectric point is 6.33
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,557 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|T2KHA0|T2KHA0_9FLAO Uncharacterized protein (Fragment)
VGIGTDMPNSSAQLEVVSTDRGVLIPQVPLTSLTDQTTISSGNIESLLVYNTNTTTTLSPGYYYWYQESWVKFLARQDLPDNIVFWDVVNNQYYYIDVNGDIQIITNSNMETLTFLNLNDDDYSLEYTDENGDVTVLDMTKLVKNLETITTIVDNGDGTITYFNENNDQITINLANGPAGADGADGMDGV
GITSTTDNGDGTFTILYSDGTTFTTPDFTGPQGAQGIAGLDGEDGADGVGIDSTTDNGDGTFTIVYTDGSTFTTINLSGTDGADGMDGVGITSTTDNGDGTFTILYSDGTTFTTPDLTGPQGAQGIAGTNGADGAAGADGVGIDSTTDNGDGTFTIVYTDGSTFTTINLSGTDGTDGMDGVGITSTTDNG
DGTFTILYTDGTTFTTPDFTGPQGLAGTDGVDGVGIDSTTDNGDGTFTIVYTDGSTFTTINLSGADGADGMDGVSITSTTDNGDGTFTILYTDGTTFTTPDLTGPQGLAGAAGADGTRVDYTTDDGDGTLTNSNTDRSNCTSTNLYRDGGADGMDGVWITYGTDGMDGTGITSSTDEADGTITDLS
Molecular weight: 58.22 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|T2KQZ6|T2KQZ6_9FLAO Uncharacterized protein
MLRWTVTFIILAIIAGILGFGGIAAGAAGIAKILFFVFLVLFVISLFTGRNPIK
Molecular weight: 5.75 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,539 |
18 |
3,557 |
1,227,168 |
37 |
2,753 |
346.8 |
39.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.39 |
0.72 |
5.89 |
6.45 |
5.14 |
6.38 |
1.91 |
7.82 |
7.46 |
9.21 |
2.14 |
6.24 |
3.35 |
3.42 |
3.24 |
6.57 |
6.08 |
6.29 |
1.12 |
4.18 |
Note: For statistics only major isoforms were used (in this case 3,539 proteins)
For dipeptide frequency statistics click
here