Burkholderia phage Bcep22
Average proteome isoelectric point is 7.14
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 77 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q6V7P1|Q6V7P1_9CAUD Putative uncharacterized protein
MSGTTGYSDEDLAGLTDEERAALQEDDGSGDATTLGDSLKDDPDAGGGEGAKSGTTDDANKGSEDGKKSDDDAAAGKTDDAAGDDDAGKKGDDTPAAAKPTIVPLLVAEAPADADAKLKEIGEKKSTLIEQFDNGDITAKEYQSQLDDLNKAERAIERAVDKAQTASEMRQQQEMNAWLGQVNDFTSKAH
PEYSTSRVRWTALDTFVKEIAAKPENANIDGAEILRQAHEMVVADLGEATPKADTGKKDDGSKDGKTAKPLKGAKIEPPPTLGKVPASDNADIDSGRWTALDRLQETDPEAHEEKLMKMSAADRDAYLASRG
Molecular weight: 34.01 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q6V7Q2|Q6V7Q2_9CAUD Putative uncharacterized protein
MKAMSILASIIGASRRFFTPAPSFAIKRIKAPRTSTRSTTAGVKRAAAKARNVKRHKAAMRRAA
Molecular weight: 6.94 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
77 |
0 |
77 |
20,072 |
43 |
4,602 |
260.7 |
28.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.03 |
0.89 |
6.48 |
6.14 |
3.0 |
8.09 |
1.85 |
4.66 |
4.51 |
7.34 |
2.58 |
3.43 |
4.03 |
5.32 |
7.5 |
5.23 |
5.76 |
6.34 |
1.39 |
2.41 |
Note: For statistics only major isoforms were used (in this case 77 proteins)
For dipeptide frequency statistics click
here