Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Average proteome isoelectric point is 6.59
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,556 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q5AX14|Q5AX14_EMENI GPI anchored protein putative (AFU_orthologue AFUA_4G03360)
MKLLLSTLFLAALARAQDNNNDNSLGDNIGDIVDNVTSGAEDVGTAISTDFASATDSLTNLPTDVSSWAESVASDASSWATDASTDAESAWSSATSVGESLFSTATSDVSSALDSISSSVSDALTSATDSVTTTVETTTTGSDGSATTTTTEITTSATDDASATQSGDESEPTDSDDVAAYATPFMGVAG
IMGVMGVVAAL
Molecular weight: 19.99 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|C8VN49|C8VN49_EMENI Uncharacterized protein
MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
Molecular weight: 6.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,555 |
1 |
10,556 |
5,089,106 |
9 |
7,214 |
482.2 |
53.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.55 |
1.26 |
5.56 |
6.19 |
3.72 |
6.79 |
2.37 |
5.01 |
4.57 |
9.16 |
2.06 |
3.68 |
4.02 |
5.99 |
6.25 |
8.38 |
5.96 |
6.12 |
1.46 |
2.9 |
Note: For statistics only major isoforms were used (in this case 10,555 proteins)
For dipeptide frequency statistics click
here