Virtual 2D-PAGE plot for 5 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|Q9E348|Q9E348_MNESV Putative p19 protein
MERAIQGSDAWQQTGGQRRVGGCGDSFAPFQLPDESPTSDEWRLHHDAYDPDTDCPLGFKEFWSVGKAISKRYHRYDWKEASLDRALGSWQGDKVITEASRFLGVDQVSCTYSIRVRGVSITLSGGSRALLRLVSMADRIKRSELQFATSAVESVVSRGCPEEETPKESE
Molecular weight: 18.96 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|Q9E350|Q9E350_MNESV Putative capsid protein
MTKAKGNDRISRLEVLVERMTAIAPGKTKRKNRKAKPARSSVVTAPVVGSAIIRSRVPKVLNSREGVVVSNTERFSILTTAVGVATFSRIDITPSNVLWLNGVAINYSKYRWISVQMYYIPIVPTTQTGLMAMGFVYDVNDSMTGTTVGMVQQMYGAVSGPIWAGYEGGSGLNTPGTKVPTGALCITLDT GRLDKSYYKYATVAQIGAMSGPEAAMYVPASVVWATDSAAVAQGGAGQIMAKYTVELLEPIPATLND
Molecular weight: 27.4 kDa Isoelectric point according different methods: