Virtual 2D-PAGE plot for 2,926 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A6EUD5|A6EUD5_9BACT Thrombospondin type 3 repeat family protein/Calx-beta domain protein (Fragment)
DLANVDLTDTDSAWYLADCDGDGVTNGTEVDPDMDGTAGPDNTDPNDPCDYNAEDITVAQTGDWLAADCDGDGVSNGDEIADGTDVNDPCDFVTGSITLPVTAITDCDGDGETSDTDLDDADPCVGGDLANVDLTDTDSAWYLADCDGDGVTNGTEVDPNSDGVAGPNDTDPNDPCDYNAEDITVAQTGD WLAADCDGDGVSNEDEISDGTDPNDPCDYLEGSITETQTGDWLAADCDGDGETNGEEIDNGTDPLDPCVGGDLANVDLTDTDSAWYLADCDGDGVTNGTEVDPNSDGVAGPNDTDPNDPCDYNAEDITVAQTGDWLAADCDGDGVTNEDEISDGTDVNDPCD
Molecular weight: 36.2 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A6ESD9|A6ESD9_9BACT 50S ribosomal protein L34
MSKRTFQPSKRKRRNKHGFRERMASVSGRKVIKARRAKGRKKISVSSEFRHKK
Molecular weight: 6.34 kDa Isoelectric point according different methods: