Phaeodactylum tricornutum (strain CCAP 1055/1)
Average proteome isoelectric point is 6.41
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,465 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B7FW84|B7FW84_PHATC Predicted protein (Fragment)
LGEALGPELGWELGALLGAALGEELGALLGEPLGAALGPELGAELGAELGPALGAELGAALGAELGAELGPELGTELGAELGDTLGWLLGTALGAELGEALGPELGWELGALLGAALGEELGALLGEPLGAALGPELGAELGAELGPALGAELGAALGAELELGTVLGWELGIELGAELGPELGTELGAE
LGDTLGWLLGTALGAELGEALGPELGWELGALLGAALGEELGALLGEPLGAALGPELGAELGAELGPALGAELGAALGAELGPELGEELGAELG
Molecular weight: 26.93 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A0T0G6|RK34_PHATC 50S ribosomal protein L34 chloroplastic
MTKRTLSNKSRYSVLKLSGFRSRMATPQGRKTIRNRRKKGRKNLTLRR
Molecular weight: 5.73 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,439 |
26 |
10,465 |
4,825,646 |
29 |
4,825 |
462.3 |
51.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.51 |
1.57 |
5.89 |
6.08 |
3.75 |
6.39 |
2.46 |
4.53 |
4.66 |
9.45 |
2.25 |
3.78 |
4.09 |
5.19 |
6.15 |
8.38 |
6.13 |
6.83 |
1.35 |
2.55 |
Note: For statistics only major isoforms were used (in this case 10,439 proteins)
For dipeptide frequency statistics click
here