candidate division Kazan bacterium GW2011_GWB1_45_10
Average proteome isoelectric point is 7.34
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 196 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1KUI4|A0A0G1KUI4_9BACT Outer membrane adhesin-like protein nonfunctional
MTLPAPVLALVSIIVGAAIIAATVTFYQRETTGIDTKYLGRSGVEIDATYVDPLNKITEGPNYSDSNNPGTGGNGVFLGDDADFDGLTITQEQLLGTDIDDPDTDDDGASDGIEVLLNTDPKDPTSGGLAYIPYPIGGVPPIGNETPAEKLILNRFYKQVRNLTKGEAVWQDSTTAAFGDTVAFIIHLEL
TNPSSAISLSATIADKLGKGLQYINDSGFIVTMNSEPEPLPPLWRDGHSLTVSPELNPQKPVTIEITFNVAVVNDPLIQNMDLTVNQAILTIQDKVYADSAIVRLNK
Molecular weight: 31.72 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1NRN7|A0A0G1NRN7_9BACT Fused DNA topoisomerase I/SWI domain-containing protein
MAVKRRKKTVKKKAAPKRKVAKRKAAPKKRKAAPKKRKTARRKKK
Molecular weight: 5.26 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
196 |
0 |
196 |
59,524 |
27 |
1,258 |
303.7 |
33.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.65 |
0.46 |
5.17 |
5.3 |
3.68 |
7.16 |
1.75 |
7.72 |
6.51 |
10.25 |
2.0 |
4.29 |
3.96 |
4.52 |
4.46 |
5.67 |
6.32 |
7.4 |
1.55 |
3.16 |
Note: For statistics only major isoforms were used (in this case 196 proteins)
For dipeptide frequency statistics click
here