Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Average proteome isoelectric point is 6.95
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 12,649 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|G4NDM3|G4NDM3_MAGO7 Uncharacterized protein
MALAEALFFSGPLVPLPLLSLLLPPPLLLLGVLSLLLLGAVGVAEGLIVKDVVEELVVCCQPGQLDWLEGQMVVLLTEVVYIVDVLLVIVGGEDDVVVPVAVVDPGWALAVAGTTVVEMAAVVVTTVGFLSSQAQSLFVVGQAIMVVALVVYIVEVLEDPEADEVELEVEEVVVDLVNIALENADTAEGN
RVFVLICVVKTVDVVEVLAEEVVVEEEEEEELVEDEDVVEEDVDCDELVLLLDEVDELEEVDEAVEDELGVVVAVGVVIQRVDEIGSFVVCEADVVVEVVTEVLVDVVSDDVVEVDDEEVELDVELDDELEVVVADTDAGVVVELVVMDTGGMSGELVEVLEVELEDVVLVLVVVELEVDVDTELVEEAE
LVEEAELVVGAVLVDAVLVSDDVPVKDDVLVEEVVDAGGEPGSGVEVVSGDVEVVPADVDDTAVLVEVDAGLVVVALELAVELVEVELMLLR
Molecular weight: 49.98 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G4N3J4|G4N3J4_MAGO7 60S ribosomal protein L39
MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
Molecular weight: 6.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
12,534 |
115 |
12,649 |
5,539,917 |
34 |
6,541 |
442.0 |
48.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.43 |
1.27 |
5.73 |
5.88 |
3.49 |
7.44 |
2.31 |
4.37 |
4.71 |
8.51 |
2.27 |
3.51 |
4.06 |
6.32 |
6.4 |
8.14 |
5.89 |
6.29 |
1.42 |
2.52 |
Note: For statistics only major isoforms were used (in this case 12,534 proteins)
For dipeptide frequency statistics click
here