Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Average proteome isoelectric point is 7.11
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 126 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q197F8|002R_IIV3 Uncharacterized protein 002R
MASNTVSAQGGSNRPVRDFSNIQDVAQFLLFDPIWNEQPGSIVPWKMNREQALAERYPELQTSEPSEDYSGPVESLELLPLEIKLDIMQYLSWEQISWCKHPWLWTRWYKDNVVRVSAITFEDFQREYAFPEKIQEIHFTDTRAEEIKAILETTPNVTRLVIRRIDDMNYNTHGDLGLDDLEFLTHLMVE
DACGFTDFWAPSLTHLTIKNLDMHPRWFGPVMDGIKSMQSTLKYLYIFETYGVNKPFVQWCTDNIETFYCTNSYRYENVPRPIYVWVLFQEDEWHGYRVEDNKFHRRYMYSTILHKRDTDWVENNPLKTPAQVEMYKFLLRISQLNRDGTGYESDSDPENEHFDDESFSSGEEDSSDEDDPTWAPDSDDS
DWETETEEEPSVAARILEKGKLTITNLMKSLGFKPKPKKIQSIDRYFCSLDSNYNSEDEDFEYDSDSEDDDSDSEDDC
Molecular weight: 53.92 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q196W0|VF378_IIV3 Uncharacterized protein 100L
MNDVHDCLVWVNDPYFHPISKRPIKYKGPTWRHYDKKCDLLGITGPKATKSPSRRTTRSPSPSRRTTRSSPSRRTTRSSPSRRTTRSPSPSGRRKQGGPAVYCGNNALDEGLLDGSKVVGTRYQCLQKGVAVGLNNPVLHHSPNYQPIVDAKIYCGTGSKLPASKLRFGTPTECMGKGYQIGQNKRFQQS
GLQQGPYIWEEDGWYKIIVPKN
Molecular weight: 23.7 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
126 |
0 |
126 |
43,365 |
60 |
1,377 |
344.2 |
39.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.14 |
1.78 |
5.8 |
5.65 |
4.42 |
4.98 |
2.18 |
5.94 |
7.09 |
8.98 |
2.12 |
5.31 |
4.38 |
5.45 |
4.82 |
7.06 |
6.77 |
6.87 |
1.35 |
3.89 |
Note: For statistics only major isoforms were used (in this case 126 proteins)
For dipeptide frequency statistics click
here