Thermus thermophilus bacteriophage P23-77
Average proteome isoelectric point is 8.05
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 37 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|C8CHM6|C8CHM6_9VIRU Putative uncharacterized protein
MGDTGDGSYLTLYGYAWLGLLDRKENRFRLFQAQVPGEGPWPLSDPRGPDVAVWVEQEVPPLPHDPREVRHMALAFDQAARHVLAYERGGQVWVRQWDPVSQVFVMRGPFPGVDPFLVQDATVGYFPPDSDVLLFHLSPDRTALVMRAQRELYATPHVIETFPSPVVLDQAVALPYQIELLGSFLDALGE
TGVVVRSEVYPVRVGDALGPATFTAPATGAYIPVVVIQDLGTDTLGTGAFAAPTTGAYIPVVVIQDLGTEALGSGTFTAPSTGAYIPVVVVQDLGTEALATGTFTAPATGTYVLVVVVQDLTASQYTDGLGYEALGTGTFAAPTTGSYTLA
Molecular weight: 36.34 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|C8CHM8|C8CHM8_9VIRU Putative uncharacterized protein
MVPGGWANRTAVLPPSRPVPGQEVGIFPQARRDGRHVPGAEAKGGQARYWDLSGFVWYWAGGMLTLNRGQKRIRRTSRGAEDATHAQG
Molecular weight: 9.62 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
37 |
0 |
37 |
5,621 |
35 |
425 |
151.9 |
16.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.12 |
0.75 |
3.9 |
5.68 |
2.6 |
10.0 |
1.23 |
3.43 |
3.1 |
10.53 |
1.97 |
1.94 |
4.34 |
8.02 |
8.31 |
4.89 |
4.89 |
8.31 |
2.03 |
2.97 |
Note: For statistics only major isoforms were used (in this case 37 proteins)
For dipeptide frequency statistics click
here