Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602)
Average proteome isoelectric point is 7.14
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 7,290 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E2Q2Q2|E2Q2Q2_STRC2 MSP1_C domain-containing protein
MRFAPLARALVPSALCATVVIGVTGPAAAAPVPAFPPDAGAEQTDAPAATDGVPDFVAELLAQIAAAQGGAMPAGQSSPDLAGLPGALAGLDEGLIQSPLNGDDDDDDDDDDDGDDDDGDEDDALAAFRAELDRLVAQVVADAQAPSTQDLPMPQDALASALASMTGNGAAPAPAAPAAQLSPSALGSLP
LLGALGQSGQPGQMGQLGPMGQLAPAAQTSPSALGSLPLLGALGQSGQPGQMGQLGQAPGAQTSPSALGSIPLLGEITQLIQAVSAGT
Molecular weight: 26.84 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B5GX84|B5GX84_STRC2 50S ribosomal protein L34
MSKRTFQPNNRRRAKTHGFRLRMRTRAGRAILASRRSKGRARLSA
Molecular weight: 5.28 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7,251 |
39 |
7,290 |
2,456,649 |
21 |
6,842 |
338.8 |
36.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.6 |
0.87 |
5.77 |
5.53 |
2.57 |
10.1 |
2.36 |
2.93 |
1.73 |
10.08 |
1.61 |
1.63 |
2.49 |
6.94 |
8.91 |
5.04 |
6.35 |
8.12 |
1.48 |
1.91 |
Note: For statistics only major isoforms were used (in this case 7,251 proteins)
For dipeptide frequency statistics click
here